PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00051.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 348aa    MW: 37611.9 Da    PI: 6.4151
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00051.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box223.5e-07436436
                 zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                             + C+ +++  + l+C+ +  +lC +C ++ H  
  Rsa1.0_00051.1_g00009.1  4 KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAA 36
                             58***************************9955 PP

2zf-B_box27.94.9e-094691342
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                              ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  Rsa1.0_00051.1_g00009.1 46 VWMCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPI 91
                             689*****************************66899999*99997 PP

3CCT705.8e-24280323144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  Rsa1.0_00051.1_g00009.1 280 REARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 323
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.48148IPR000315B-box-type zinc finger
SMARTSM003361.8E-12148IPR000315B-box-type zinc finger
PfamPF006432.9E-5443IPR000315B-box-type zinc finger
CDDcd000211.38E-8548No hitNo description
PROSITE profilePS5011910.9934491IPR000315B-box-type zinc finger
PfamPF006432.1E-74691IPR000315B-box-type zinc finger
CDDcd000219.71E-104791No hitNo description
SMARTSM003362.8E-114991IPR000315B-box-type zinc finger
PfamPF062036.7E-18280322IPR010402CCT domain
PROSITE profilePS5101716.767280322IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MASKLCDSCK SATAALYCRP DAAFLCLSCD SKVHAANKVA SRHARVWMCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLARRHERVP ITPFYDPVSG ADGSGKHTAV NFLNDCYFAD  120
LDGNASREEE EEEAASWLLP NPKTAAPAVP GDSPEMNTGQ QFLFPDLDLD YGTVDPKLES  180
REQNSSGADG VVPVETRTVR VPTVNENCYE LDFTGGSKSF TTYGHNCVSH SVSSSSLEVG  240
VVPDGGSVAD VSYPYGGPAT SGTGIDSGTQ RAVPLTSAER EARVMRYREK RKNRKFEKTI  300
RYASRKAYAE MRPRIKGRFA KRTDTSESND VVVGHGGMFS GFGLVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU9497860.0KU949786.1 Raphanus sativus var. raphanistroides isolate Rs-2 CONSTANS-like zinc finger protein 4 (COL4) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611790.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T90.0COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A0D3E1E80.0A0A0D3E1E8_BRAOL; Uncharacterized protein
STRINGBra036528.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.10.0CONSTANS-like 4